PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0042s0046.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 386aa    MW: 44180.6 Da    PI: 9.4539
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0042s0046.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.79.8e-148583587
                         EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                   B3 35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                         t  l  +sg++W v++  +  ++  ++t+GW+ Fv++n +++gDf+ Fkl g+
  Kaladp0042s0046.2.p  8 TAELAGRSGQTWLVEV--DYDGKDLYFTDGWQAFVEDNMVQDGDFLFFKLLGN 58
                         678999**********..888888*************************9886 PP

2B3573.6e-18134225196
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f+k  t s+    + l++p  fa+eh+++ +++ +++l+++++ sW+v++   +++g++ l +GW  F+++n+L+ gD++ F+l+gr   
  Kaladp0042s0046.2.p 134 FEKHITISNIEHGHYLRIPSYFAQEHSLNYKSNEKMVLRTSRNSSWKVNI--INRGGEISLCRGWAAFARENNLRLGDVCNFELVGR--L 219
                          677777777777899***********88888999****************..999999*************************9985..5 PP

                          ..EEEE CS
                   B3  91 elvvkv 96 
                          e++v+v
  Kaladp0042s0046.2.p 220 EMLVHV 225
                          556665 PP

3B353.44.8e-17285380296
                          EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                   B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLkegDfvvFkldgrse 89 
                          +  +++++v ks+ l +p  f++e+++  e++ +++l++e+   W + +i++k+ ++  + l++GW +Fv++n++kegD++ F+l++r e
  Kaladp0042s0046.2.p 285 VALMKKHHVEKSA-LNIPAWFFRENSLHYERNEKMVLRSEKDSLWLLSIIHSKYNNKtlCRLSGGWIDFVRDNNIKEGDTCKFELVNRLE 373
                          4455556666665.***********99999999****************99777777679999*********************997644 PP

                          E..EEEE CS
                   B3  90 felvvkv 96 
                           +++++ 
  Kaladp0042s0046.2.p 374 MKFHIMP 380
                          4344444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.366169IPR003340B3 DNA binding domain
CDDcd100173.11E-11167No hitNo description
SMARTSM010190.13169IPR003340B3 DNA binding domain
PfamPF023624.3E-11658IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-14771IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.24E-14871IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.7E-23127228IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.45E-20131227IPR015300DNA-binding pseudobarrel domain
CDDcd100175.01E-17132225No hitNo description
PfamPF023621.4E-15134225IPR003340B3 DNA binding domain
PROSITE profilePS5086314.015134229IPR003340B3 DNA binding domain
SMARTSM010198.9E-13134231IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-19281380IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-18281380IPR015300DNA-binding pseudobarrel domain
CDDcd100175.16E-17282378No hitNo description
PROSITE profilePS5086312.323283382IPR003340B3 DNA binding domain
PfamPF023621.7E-14284380IPR003340B3 DNA binding domain
SMARTSM010191.6E-16284382IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MDERKFGTAE LAGRSGQTWL VEVDYDGKDL YFTDGWQAFV EDNMVQDGDF LFFKLLGNLM  60
FSFIIYDETM CEKEAAFNGK CSRGRDGVVE AVEEPMGLKP VKRRNMGCSQ PEGSLFTSMD  120
KTAVKTSTSV KPSFEKHITI SNIEHGHYLR IPSYFAQEHS LNYKSNEKMV LRTSRNSSWK  180
VNIINRGGEI SLCRGWAAFA RENNLRLGDV CNFELVGRLE MLVHVTHQDK VIEQKQLNVA  240
APKIRPSERA VGVSQPKLRQ GSPITTERQK AAGRSRPSLV KPSFVALMKK HHVEKSALNI  300
PAWFFRENSL HYERNEKMVL RSEKDSLWLL SIIHSKYNNK TLCRLSGGWI DFVRDNNIKE  360
GDTCKFELVN RLEMKFHIMP RSKQD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197103LKPVKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.17e-17B3 family protein